Oulipost #18: Homoconsonantism

Today is day 18 of Ouliposting…and it was one of those more “surreal” challenges where I just had to follow the rules and let the words come as they may…there’s obviously some interesting word choices, but as an overall poem, it’s not my favorite of the month…! With this prompt we were to keep all consonants of one sentence and then replace all of the vowels. For whatever reason, this was much harder than the other way around…maybe it’s the way my brain is wired…or maybe it’s because I have all kinds of things going on behind the scenes. Here are the consonants that I was allowed to use in this order:

NTWSNTNPPRTNTYTSTLBSTWSCHNCTGTSMGYSNMTNNDMKSMTHNGHPPN

Anyway, for better or worse, and this may be way worse…here is my poem of the day, the source sentence used, the source, and the Oulipost prompt:

No Math

Nite isn’t in

app art,

not yet!

 

[Steel y bust]

wise chain cat,

goat see

 

moi gays

one moot,

a no na = doom:

 

Eke!

Sue math

in Ohio…

 

pi pun.

 

Original sentence:

“No, it wasn’t an opportunity [to steal a base] – it was a chance to get some guys in motion and make something happen…”

Source:

Wagner, John. “Struggling Mud Hens Can’t Steal a Win Against Clippers.” Toledo Blade 18 Apr. 2014. Web.

Oulipost prompt:

Homoconsonantism

Choose a sentence or short passage from your newspaper to complete a homoconsonantism. In this form, the sequence of consonants in a source text is kept, while all its vowels are replaced. For example:

ORIGINAL: To be or not to be: that is the question.
CONSONANTS ONLY: T b r n t t b t t s t h q s t n
FINAL PRODUCT: As burnt tibia: it heats the aqueous tone.

See you tomorrow!

 

Advertisements

Leave a Reply

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out / Change )

Twitter picture

You are commenting using your Twitter account. Log Out / Change )

Facebook photo

You are commenting using your Facebook account. Log Out / Change )

Google+ photo

You are commenting using your Google+ account. Log Out / Change )

Connecting to %s